DPCfam | MC6065
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Residues in low-complexity regions (%) | 4.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.17 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00566 |
| Sequences matching dominant architecture (%) | 97.37 |
| Average overlap percent | 6.76 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A284CCC | 300-374 | 75 | GVKILFRVGLVLLKHSLGSSEKLKACQGQYETMERLRSLNPKIMQETFLVQEVIELPVTERQIEREHLIQLRKWK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5K4FBH7-F1 | 571-646 | 100.00 | 95.46 | View in AlphaFoldDB ↗ |