DPCfam | MC60544
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Residues in low-complexity regions (%) | 4.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.62 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06632 |
| Sequences matching dominant architecture (%) | 71.43 |
| Average overlap percent | 12.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9P5Y7 | 1-126 | 126 | MTSSSSTIIRIPRTDTDQEDECILGDVVHSGGSSARGSKPLNLKIIATEGEEPYALTLKHDHINDLRASSSACSPTEWQSILSSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1HDX2-F1 | 4-145 | 99.13 | 77.39 | View in AlphaFoldDB ↗ |