DPCfam | MC60411
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Residues in low-complexity regions (%) | 0.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 46.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I9GCU4 | 1565-1622 | 58 | SLISAPSEQSSVSTRIRRMQIPTKASDVDQFLDAIFEQVLPANDLEQTDDNHFNAAMI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7DTH3-F1 | 428-490 | 96.77 | 63.85 | View in AlphaFoldDB ↗ |