DPCfam | MC60196
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 971 |
|---|---|
| Mean domain length (aa) | 262 ± 23 aa |
| Residues in low-complexity regions (%) | 1.57 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 20.1 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF14022 |
| Sequences matching dominant architecture (%) | 99.0 |
| Average overlap percent | 92.48 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009F3D188 | 13-265 | 253 | RQHTVPRFLLRHFSAPGKGKRRRLHAFDKATGRAYATTPDDATVRNTFYNLDDHPERLSLEPLLGIYEHDAAPVIAALLAHRDIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VQL5-F1 | 12-291 | 84.82 | 92.29 | View in AlphaFoldDB ↗ |