DPCfam | MC60047
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 314 ± 53 aa |
| Residues in low-complexity regions (%) | 7.1 |
| Residues in coiled-coil regions (%) | 15.34 |
| Predicted disordered residues (%) | 65.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000975336D | 44-333 | 290 | MATGGHHSFKTASTDPRPRRGWQRTASASDKEDNISNHSSNPVEHRPNNWDFSDWKPRAPIDNTKRRKKGNPEREREQSLCLDSP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2K0X1-F1 | 17-300 | 91.13 | 47.36 | View in AlphaFoldDB ↗ |