DPCfam | MC5992
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 116 ± 7 aa |
| Residues in low-complexity regions (%) | 5.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.79 |
| Average transmembrane regions | 0.87 |
| Dominant Pfam architecture(s) | PF03040 |
| Sequences matching dominant architecture (%) | 99.15 |
| Average overlap percent | 39.69 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D6KEX8 | 13-117 | 105 | IPRSILRTIGKFQHTLDPNAEAKVIEEFRASRLQTISSLRFLLILIVVPLLINQLSRNFFIAPIIEKFWNSQELNIFLNSSQEEK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A6MVV9-F1 | 13-126 | 98.28 | 86.79 | View in AlphaFoldDB ↗ |