DPCfam | MC59777
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Residues in low-complexity regions (%) | 3.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01783 |
| Sequences matching dominant architecture (%) | 1.01 |
| Average overlap percent | 37.38 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A165WHE7 | 90-190 | 101 | SSTSSEEIYKIFESQFIGTKLFLSVQWSMLKELKKLALRAGFNEDEIQAQGWGEKEERVFCVKCYHLNKLTAQKQVTCEKCHASL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7L8C5-F1 | 95-133 | 34.55 | 69.46 | View in AlphaFoldDB ↗ |