DPCfam | MC59711
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Residues in low-complexity regions (%) | 0.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01821 |
| Sequences matching dominant architecture (%) | 28.12 |
| Average overlap percent | 47.29 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A6H2B5 | 32-112 | 81 | KDLIETCCAAGQQWAIDNDECQEIPENGAESDVCRIAQRHCCVSYLKEKSCMAGIQCCDCCGLGLRVRAEGQSCESNPNLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P37889-F1 | 427-507 | 100.00 | 77.75 | View in AlphaFoldDB ↗ |