DPCfam | MC59690
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Residues in low-complexity regions (%) | 0.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.38 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03016 |
| Sequences matching dominant architecture (%) | 97.87 |
| Average overlap percent | 29.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q10M35 | 182-261 | 80 | RALQRRLLDYLAARPEWRRSGGRDHVVLAHHPNGMLDARYKLWPCVFVLCDFGRYPPSVAGLDKDVIAPYRHVVPNFAND... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1JK55-F1 | 233-307 | 98.68 | 96.14 | View in AlphaFoldDB ↗ |