DPCfam | MC5968
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 557 ± 36 aa |
| Residues in low-complexity regions (%) | 1.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06439 |
| Sequences matching dominant architecture (%) | 54.76 |
| Average overlap percent | 31.16 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A3CB191 | 42-615 | 573 | WKMVGGVNADWEHNDFLSTTRGTGILVNLPKSKNGPHLISGFEHGDMELELDFMVPKGSNSGIYLQGRYEIQIFDSWGKVNPNSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A3DC75-F1 | 393-499 | 18.85 | 95.80 | View in AlphaFoldDB ↗ |