DPCfam | MC59675
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 306 ± 39 aa |
| Residues in low-complexity regions (%) | 3.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C2Z6V7 | 165-503 | 339 | DDGDLARFIKGFYRILDLIAEQGSGGLVDKIVISETPFRAFINDICPGAYSSVTKVNFKALDELGIKPIGIYGSKQQIVRLMSQF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q57YR3-F1 | 706-760 | 17.41 | 70.03 | View in AlphaFoldDB ↗ |