DPCfam | MC59591
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 206 ± 18 aa |
| Residues in low-complexity regions (%) | 10.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.85 |
| Average transmembrane regions | 1.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W5DB66 | 4-221 | 218 | AARLFADDEELGKKDDDHRPGKGVLIPAIWPLWQTPLRVRRRRLALGFAALMFLYFFIKYIPTDLGPANKRGNMRTPTAGGRLGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VNY7-F1 | 11-219 | 99.51 | 69.32 | View in AlphaFoldDB ↗ |