DPCfam | MC59434
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Residues in low-complexity regions (%) | 2.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.82 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00179 |
| Sequences matching dominant architecture (%) | 7.28 |
| Average overlap percent | 2.51 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J3CER5 | 474-568 | 95 | MRRPPKYFENFAYGHFYSCAHDFLKACDAYRNGAPVGSKVKVKVKEGDEDVKVKEGGEVVVEERSASCSPKFRKDVTNFVETLLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6MC51-F1 | 1335-1421 | 100.00 | 84.03 | View in AlphaFoldDB ↗ |