DPCfam | MC59348
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Residues in low-complexity regions (%) | 0.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.49 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF04073 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 45.98 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C6PXN8 | 26-87 | 62 | VEESKTVDLKKLSKDIGSTPLSFGSEERLYNNLGLMRGSVTPMGLINNTDKKVKLIIDSDLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9L4Q7-F1 | 69-124 | 96.55 | 96.13 | View in AlphaFoldDB ↗ |