DPCfam | MC59305
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 168 ± 17 aa |
| Residues in low-complexity regions (%) | 13.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.19 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009F49A57 | 2-173 | 172 | DLLFRDYEVQIEALRQRDYEASSQEQRLLEQSRIVVADRLSAQLGAYLAVHSVTGGVWRGTLANLGLGWLQLDTDSGELLIPLHQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O05223-F1 | 8-119 | 60.00 | 83.15 | View in AlphaFoldDB ↗ |