DPCfam | MC59240
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 501 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Residues in low-complexity regions (%) | 0.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.6 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF14490 |
| Sequences matching dominant architecture (%) | 89.34 |
| Average overlap percent | 83.25 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C6LDW1 | 403-494 | 92 | LFLQDHGVNTSFAAKIYRQYGNESIAKVKENPFCLADDIWGIGFKTADSIAEKLGFQKESFVRLRSGIMYTLSSLADEGHVYAGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34481-F1 | 163-256 | 95.88 | 88.25 | View in AlphaFoldDB ↗ |