DPCfam | MC59051
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 121 ± 26 aa |
| Residues in low-complexity regions (%) | 1.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07250 |
| Sequences matching dominant architecture (%) | 97.26 |
| Average overlap percent | 57.63 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146HSZ8 | 207-285 | 79 | GGGAEPTYEFYPSNGQTPQTMNFMLKTSGLNSYAHTYLLASGNLFVQANYSTMIWNPDTNTETDLPDMPNQVVRVYPAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9SVX6-F1 | 162-295 | 98.57 | 95.78 | View in AlphaFoldDB ↗ |