DPCfam | MC58763
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 712 ± 88 aa |
| Residues in low-complexity regions (%) | 12.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 62.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09494 |
| Sequences matching dominant architecture (%) | 92.66 |
| Average overlap percent | 10.62 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q2U6E8 | 94-820 | 726 | SQDKPKRRGRKPASESQTVLGDSGLAGLAQQSAPKKTAGARKKRVDSEGKRGKATNRTIMGRVAKSGNVQAKPPQEKIMDVSTPN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2HCM6-F1 | 164-756 | 80.57 | 54.20 | View in AlphaFoldDB ↗ |