DPCfam | MC58530
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 412 ± 75 aa |
| Residues in low-complexity regions (%) | 18.45 |
| Residues in coiled-coil regions (%) | 4.45 |
| Predicted disordered residues (%) | 16.5 |
| Average transmembrane regions | 6.1 |
| Dominant Pfam architecture(s) | PF07730 |
| Sequences matching dominant architecture (%) | 71.79 |
| Average overlap percent | 11.69 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q0RLH3 | 35-467 | 433 | LSVLFLPIAGALTWSLGSAGLPSRVCGVFLVLGGLLARRRRLDPQTGRLMMLSGLAMYLGDLRFSPQSVLFAVGFWLAYLYAGFL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EZ23-F1 | 161-246 | 19.62 | 79.55 | View in AlphaFoldDB ↗ |