DPCfam | MC58433
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 163 ± 14 aa |
| Residues in low-complexity regions (%) | 2.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.44 |
| Average transmembrane regions | 0.37 |
| Dominant Pfam architecture(s) | PF05309 |
| Sequences matching dominant architecture (%) | 99.51 |
| Average overlap percent | 89.28 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D5L1U2 | 23-183 | 161 | IISGQAIANVLLALLVGWTVLHDTTRIVPPEVKRPYQIGAGQADQDYLSDMSGYVLSLILTSTPETVDYNNSILLKLVEPDQYPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P12057-F1 | 21-182 | 97.59 | 88.51 | View in AlphaFoldDB ↗ |