DPCfam | MC58044
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Residues in low-complexity regions (%) | 1.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.76 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15717 |
| Sequences matching dominant architecture (%) | 86.89 |
| Average overlap percent | 43.54 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4ZB98 | 1858-1964 | 107 | DTRQLDLQIKGIMQEVIPYLKEHMDDVCSPQLLAYIRRLVLGLARQKDESREFVRFFNRQLGSILEDSLAKFSGRKMRECGEDLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8AV28-F1 | 1487-1594 | 99.08 | 84.97 | View in AlphaFoldDB ↗ |