DPCfam | MC5793
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 255 ± 23 aa |
| Residues in low-complexity regions (%) | 5.83 |
| Residues in coiled-coil regions (%) | 0.78 |
| Predicted disordered residues (%) | 25.39 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182LJG8 | 1857-2141 | 285 | VYYPVRHQLVQQMINSMQRLGNVGNTSTEYRKLTIDLAEVVIKWEMQRVKDESDEAAAAAAAVGEGTGVPGADESMEMGATGGAD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q80YV3-F1 | 673-925 | 100.00 | 67.37 | View in AlphaFoldDB ↗ |