DPCfam | MC57781
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Residues in low-complexity regions (%) | 2.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S2YHP7 | 157-236 | 80 | HSPEQVFYFDAEDHLLRRQDYNVDVLGANYPVAHYKTDHETYDGLSFPTRHRVVPRNPDNTSRSGPIIVAIDIESVTTSA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O33271-F1 | 163-241 | 98.73 | 96.22 | View in AlphaFoldDB ↗ |