DPCfam | MC57601
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Residues in low-complexity regions (%) | 1.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F8JPY7 | 8-78 | 71 | VEAEATGTPTVIEHGGREYTIPAPKDVPLEVVWAQDDTDIVRLVLGEDQWSRYLATRPTLGDFQALAEKIN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q32J73-F1 | 169-199 | 34.88 | 96.86 | View in AlphaFoldDB ↗ |