DPCfam | MC5712
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 254 ± 46 aa |
| Residues in low-complexity regions (%) | 10.58 |
| Residues in coiled-coil regions (%) | 19.04 |
| Predicted disordered residues (%) | 43.8 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00536 |
| Sequences matching dominant architecture (%) | 72.22 |
| Average overlap percent | 19.59 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000B3AA30F | 968-1215 | 248 | LDLSSLLEGRSDSSSSGDARAIRRQLRGLENMYAEVLQLLGVRKPASLAKQPTWESRLSSKRRYGSMSSLPSSSVSSRPVRDKRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0JDT6-F1 | 142-209 | 27.89 | 85.39 | View in AlphaFoldDB ↗ |