DPCfam | MC57037
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Residues in low-complexity regions (%) | 15.43 |
| Residues in coiled-coil regions (%) | 17.45 |
| Predicted disordered residues (%) | 18.25 |
| Average transmembrane regions | 0.48 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1R1SM16 | 6-92 | 87 | EIESGIARLEGYLLCQRELGDARAEAEAYADRLPWLTATQREEVVRLYAEERVELSRRMLRRIADRCEELRAEYTARYEELRRRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7FA85-F1 | 45-89 | 46.53 | 87.86 | View in AlphaFoldDB ↗ |