DPCfam | MC56830
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 641 |
|---|---|
| Mean domain length (aa) | 311 ± 44 aa |
| Residues in low-complexity regions (%) | 2.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08529- PF13184 |
| Sequences matching dominant architecture (%) | 44.37 |
| Average overlap percent | 79.9 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F7R0E6 | 17-351 | 335 | EEKNLPEDQVQDIVQQALAAAWRRDYGDREQEVRVTMNINTGEVIAYVTKEIVDEVEDPRTQLSLAEAKVMKKNAKLGDQIEIIQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9KA74-F1 | 24-343 | 100.00 | 92.25 | View in AlphaFoldDB ↗ |