DPCfam | MC56132
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 66 ± 12 aa |
| Residues in low-complexity regions (%) | 0.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.3 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00303 |
| Sequences matching dominant architecture (%) | 99.25 |
| Average overlap percent | 27.29 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R4TIC7 | 126-191 | 66 | DLGPIYGFQWRHFNADYDNCDSDYTGKGVDQLKYIIDQLKNPETRNSRRLIMTAWNPCQINDMALP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P06785-F1 | 111-178 | 100.00 | 97.93 | View in AlphaFoldDB ↗ |