DPCfam | MC55828
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 530 ± 54 aa |
| Residues in low-complexity regions (%) | 8.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.46 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W7TE40 | 63-588 | 526 | RFVEPPGLYRLLPVLKLRRYLILSGERKSGLWTAGLNMLGECASLCGVELRPRSAVVDEQSSLDDLLGRDDRSHAVLLDLTGTDP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O28972-F1 | 190-397 | 33.33 | 86.06 | View in AlphaFoldDB ↗ |