DPCfam | MC55645
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 758 ± 54 aa |
| Residues in low-complexity regions (%) | 12.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 67.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12814 |
| Sequences matching dominant architecture (%) | 96.0 |
| Average overlap percent | 18.54 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B7Y729 | 550-1316 | 766 | VETRSTAVQTEEILSDKRLANLPVHLRPSAITSRPSSPVIATAITTDDPRHFTPVPGQLPPRNPRRLTSKRSLTDMPSSPPVSPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VRE0-F1 | 553-1353 | 99.87 | 49.33 | View in AlphaFoldDB ↗ |