DPCfam | MC55632
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 190 ± 12 aa |
| Residues in low-complexity regions (%) | 3.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18884- PF18884 |
| Sequences matching dominant architecture (%) | 12.77 |
| Average overlap percent | 19.52 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J4T7R0 | 254-442 | 189 | MPKNFKAGQDSDQDGLTDKEEELLLTKPDTNDSDGDGYQDLSEFMNFYNPAGSGRLDANAGLKKYDNEIYNYNTLYPAGWAVNKI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q04732-F1 | 65-117 | 26.98 | 87.61 | View in AlphaFoldDB ↗ |