DPCfam | MC55517
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Residues in low-complexity regions (%) | 1.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07669 |
| Sequences matching dominant architecture (%) | 95.59 |
| Average overlap percent | 10.0 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E2EIP9 | 280-384 | 105 | MFGATVDTSILALEKSHNRNELQAIDLVQRDNNPLKRLENMSDYIEQNKLQISFNKDDSWIILSPIEQSIKRKIESVGTPLKDWN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0PC94-F1 | 894-1014 | 99.15 | 87.94 | View in AlphaFoldDB ↗ |