DPCfam | MC55487
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Residues in low-complexity regions (%) | 2.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00547 |
| Sequences matching dominant architecture (%) | 98.17 |
| Average overlap percent | 96.38 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1H6BRP5 | 1-91 | 91 | MIHVAAEVARKRKERGVRLNYPEAVAILTAHVLEGARDGRTVAELMVPPDKTVLCREDLMEGVAEMISDVQIEATFPDGTKLVTI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A3DGG0-F1 | 1-100 | 99.01 | 97.47 | View in AlphaFoldDB ↗ |