DPCfam | MC5544
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 563 ± 69 aa |
| Residues in low-complexity regions (%) | 11.08 |
| Residues in coiled-coil regions (%) | 27.09 |
| Predicted disordered residues (%) | 39.45 |
| Average transmembrane regions | 4.14 |
| Dominant Pfam architecture(s) | PF09726 |
| Sequences matching dominant architecture (%) | 56.1 |
| Average overlap percent | 93.89 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N5DZ77 | 93-762 | 670 | SLVYLKLLMVWAFVMMADFLLDLRFEYIWPFWLMLRSIYDSFRYQGMTFSFFFICVTFTSDMICFIFVPVQWIFFIASTYVWVQY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2TLY1-F1 | 1-652 | 100.00 | 68.24 | View in AlphaFoldDB ↗ |