DPCfam | MC5539
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1621 |
|---|---|
| Mean domain length (aa) | 131 ± 13 aa |
| Residues in low-complexity regions (%) | 10.42 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 2.37 |
| Average transmembrane regions | 3.44 |
| Dominant Pfam architecture(s) | PF07786 |
| Sequences matching dominant architecture (%) | 21.75 |
| Average overlap percent | 64.77 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F8IRV4 | 4-103 | 100 | PVTGANAVARWVVDVFFHQKFITLFSMLFGASIFLVGGERWDKARGRLLRRRLFWLAVIALIHGLAFWYGDVLLLYAWSGLFVML... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P42107-F1 | 10-150 | 98.41 | 94.81 | View in AlphaFoldDB ↗ |