DPCfam | MC55186
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Residues in low-complexity regions (%) | 9.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.12 |
| Average transmembrane regions | 0.5 |
| Dominant Pfam architecture(s) | PF00150 |
| Sequences matching dominant architecture (%) | 30.43 |
| Average overlap percent | 8.22 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G0GCP9 | 7-69 | 63 | KIVFGLLFVGLIIFYGCLWLLSNKQYKVDYGISFSRFHAQSLGLDWQKTYLTMLDELKPKYIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A6NE01-F1 | 1268-1289 | 32.84 | 77.12 | View in AlphaFoldDB ↗ |