DPCfam | MC5503
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Residues in low-complexity regions (%) | 0.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02866 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 38.62 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B8XFS8 | 11-76 | 66 | DKYDALVHRVQFGGDEVVQAQGGAGSATLSMAYAGFRFAESVIKAAFKGEKNIVEPTYVYLPGIAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VEB1-F1 | 222-280 | 96.72 | 95.68 | View in AlphaFoldDB ↗ |