DPCfam | MC54823
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 135 ± 26 aa |
| Residues in low-complexity regions (%) | 13.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 70.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12752 |
| Sequences matching dominant architecture (%) | 73.21 |
| Average overlap percent | 37.82 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A016SP40 | 18-149 | 132 | DVAEDWENDEASESMEKQLSERFKQVRILQRAQADKEARKEKAARCQEEARLNPSLIPTPSVVPAGPGGAPQAPVRILRRPESSE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7Z422-F1 | 5-149 | 99.25 | 67.50 | View in AlphaFoldDB ↗ |