DPCfam | MC54410
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.09 |
| Average transmembrane regions | 1.89 |
| Dominant Pfam architecture(s) | PF04474 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 30.32 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009ED3DD0 | 47-115 | 69 | EGISQEEFLDKYVAIVVLFCASGTGVFGSMHEGMTGDPSILYIKTILDFFTAGIFAITLGYAVSAIAVP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q46831-F1 | 99-163 | 97.01 | 93.31 | View in AlphaFoldDB ↗ |