DPCfam | MC54113
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 605 ± 47 aa |
| Residues in low-complexity regions (%) | 2.93 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 39.4 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF10513 |
| Sequences matching dominant architecture (%) | 94.59 |
| Average overlap percent | 16.62 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A166HUN1 | 1216-1799 | 584 | SPLGEISPAWHGERINVVHSGFGTGPRKPRTQVHYAMPFAGSEFSPRHKPLNQNGHPFRRVRRASEKRTYDDTKGSQRNLELLAC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1MWL9-F1 | 1010-1507 | 80.90 | 57.21 | View in AlphaFoldDB ↗ |