DPCfam | MC54039
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 285 ± 41 aa |
| Residues in low-complexity regions (%) | 9.15 |
| Residues in coiled-coil regions (%) | 0.18 |
| Predicted disordered residues (%) | 45.86 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02135- PF02172 |
| Sequences matching dominant architecture (%) | 90.32 |
| Average overlap percent | 93.49 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8C915 | 404-682 | 279 | HAHRCQQREKEPSDSHPCNLPHCKTMKSVLRHMMTCNAGKKCSFSHCASSRQIIAHWKNCKKGECPVCKPLQNLAHGSGGVGDPK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45481-F1 | 346-671 | 100.00 | 54.93 | View in AlphaFoldDB ↗ |