DPCfam | MC54035
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 55 ± 6 aa |
| Residues in low-complexity regions (%) | 5.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q54GM7 | 1056-1112 | 57 | PPQKCLGNPECGGKTQGFCSPTGCICYSPWIGTTCTSQIIIVPQPSINTTNPNVEIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54VT0-F1 | 293-346 | 94.64 | 72.60 | View in AlphaFoldDB ↗ |