DPCfam | MC54006
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Residues in low-complexity regions (%) | 1.98 |
| Residues in coiled-coil regions (%) | 1.04 |
| Predicted disordered residues (%) | 6.02 |
| Average transmembrane regions | 0.53 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R9PKW5 | 262-354 | 93 | PTLSLAAIAIYYFRVLLFNYKSVKSQLLQIDLRKTLCRFIQHYSEYSSEIKKQDSESLAKFENIIFSGIVTEDGNLPSTFDGVEQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GY02-F1 | 301-394 | 95.96 | 72.15 | View in AlphaFoldDB ↗ |