DPCfam | MC53928
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Residues in low-complexity regions (%) | 3.47 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 35.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01039 |
| Sequences matching dominant architecture (%) | 97.28 |
| Average overlap percent | 30.87 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E5G5K0 | 409-468 | 59 | QKSQSLQCSNVETNSAAAYGMVDEVIEPKQTRQRVYDILLMLENKTEPLKGKKHGNIPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I3R7F1-F1 | 434-516 | 100.00 | 95.24 | View in AlphaFoldDB ↗ |