DPCfam | MC53723
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 52 ± 5 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03951 |
| Sequences matching dominant architecture (%) | 84.21 |
| Average overlap percent | 69.18 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K1PIH8 | 397-454 | 58 | VNDCPAWDSYMWNSIYQKDSEFIPMLTKPVAMFENPFLKSPHKLVLCDMWKTNDEPAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G4V9E4-F1 | 57-108 | 98.11 | 96.93 | View in AlphaFoldDB ↗ |