DPCfam | MC53581
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 81 ± 4 aa |
| Residues in low-complexity regions (%) | 1.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.32 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08543 |
| Sequences matching dominant architecture (%) | 93.16 |
| Average overlap percent | 14.15 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R5H6X0 | 3-86 | 84 | RIVTIQDFSCVGNCSLTAAIPVLSAAGVECCGIPTALLSNHTGFPTFYSIDLTDELAPIGAQLKKEHIDFDGIYTGYIASVEQV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q83K78-F1 | 18-102 | 98.80 | 97.78 | View in AlphaFoldDB ↗ |