DPCfam | MC53572
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Residues in low-complexity regions (%) | 2.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15769 |
| Sequences matching dominant architecture (%) | 96.15 |
| Average overlap percent | 28.99 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q8IWA6 | 131-225 | 95 | RPFTPIHSCIISPSLTEAHVEPLFRQLCALHWLLEALTIDHTHHTMKPVITCWNPKDPGGSKSTIKKINKDKSMGQKWEHFITAP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IWA6-F1 | 128-215 | 96.67 | 85.52 | View in AlphaFoldDB ↗ |