DPCfam | MC53562
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 674 ± 83 aa |
| Residues in low-complexity regions (%) | 2.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.29 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF10493 |
| Sequences matching dominant architecture (%) | 81.25 |
| Average overlap percent | 64.35 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067D5H9 | 23-698 | 676 | FARLQQLARIGSDAARNWQQIAFLNQCNELESNAKWWHHLNLLGIACEHKAFQSERRNVQVLQAIVPQLLQATSLDLYCVLEFTR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P50748-F1 | 1341-2059 | 99.86 | 70.95 | View in AlphaFoldDB ↗ |