DPCfam | MC53561
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 931 |
|---|---|
| Mean domain length (aa) | 147 ± 19 aa |
| Residues in low-complexity regions (%) | 7.29 |
| Residues in coiled-coil regions (%) | 0.44 |
| Predicted disordered residues (%) | 2.82 |
| Average transmembrane regions | 3.9 |
| Dominant Pfam architecture(s) | PF13968 |
| Sequences matching dominant architecture (%) | 96.8 |
| Average overlap percent | 37.16 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M8A5B2 | 20-139 | 120 | RVLVIVSFTAHLTLALLAGIRRRRHSGVWRSLVWLADYVTEIGTPIALTKVFIDTASVDTEQELKALVAYREQQMFAFWAPFLLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q33AD5-F1 | 10-161 | 99.34 | 89.85 | View in AlphaFoldDB ↗ |