DPCfam | MC53550
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Residues in low-complexity regions (%) | 0.53 |
| Residues in coiled-coil regions (%) | 1.32 |
| Predicted disordered residues (%) | 13.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F6UGT4 | 816-888 | 73 | DSSECLADDCSIIAGGNLIGWHPDSAAVLWRRILGILGDVNNIQSPKIHAKVFGYLYELWYKLAKIRDNLAIS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8Q8N1-F1 | 1072-1138 | 91.78 | 86.97 | View in AlphaFoldDB ↗ |